Need help? Call Or Text us, and a team member will be happy to assist you. +1-786-957-0245

Sale!

LL37

LL37 is a 37-residue cationic amphipathic peptide derived from a cathelicidin sequence. Suitable for membrane-interaction, secondary-structure, and cellular-signaling research. Research use only; not for human or veterinary use.

Original price was: $125.00.Current price is: $110.00.

Purchase Peptides

Description

LL37 is a 37-residue, cationic amphipathic peptide derived from a cathelicidin sequence. It is used in membrane-interaction, secondary-structure, and cellular signaling studies. Supplied as lyophilized powder for research use only; not for human or veterinary use.

CAS: 154947-66-7
PubChem CID: 16198951
Molecular Formula: C205H340N60O53
Molecular Weight: 4493.37 g/mol
Amino Acid Sequence: [LL-37, 37 aa] (37 aa)
Physical Form: Lyophilized Powder
Purity: ≥99%
Storage: -20°C, protected from light and moisture

Research Use Only

All products on this site are strictly for analytical, research, laboratory, and development use only and are not for human or animal consumption of any kind and are not intended for medical, therapeutic, or diagnostic use. 

The statements made within this website have not been evaluated by the US Food and Drug Administration.  

The statements and the products of this company are not intended to diagnose, treat, cure or prevent any disease.    

BioS Peptides is not a compounding pharmacy or chemical compounding facility as defined under 503A of the Federal Food, Drug, and Cosmetic act.  

BioS Peptides is not an outsourcing facility as defined under 503B of the Federal Food, Drug, and Cosmetic act.

By accessing this site, you confirm that you are at least 21 years of age and that  all products are sold exclusively for research, laboratory, and analytical purposes.