Need help? Call Or Text us, and a team member will be happy to assist you. +1-786-957-0245
Need help? Call Or Text us, and a team member will be happy to assist you. +1-786-957-0245
LL-37 is a human cathelicidin-derived antimicrobial peptide with 37 amino acids. Research investigations are examining its membrane-active properties, immunomodulatory effects, and antimicrobial mechanisms. Studies explore its interactions with bacterial membranes, toll-like receptors, and inflammatory signaling pathways. Scientists continue to investigate its role in innate immunity and host defense mechanisms.
This material is for research purposes only and is not intended for human use.
Note: Current batch was underfilled from manufacturer. Pricing is discounted to reflect this.
Original price was: $125.00.$110.00Current price is: $110.00.
LL-37, the only human cathelicidin, is a 37-amino acid peptide that serves as a critical component of the innate immune system. Its primary mechanism of action involves the disruption of microbial membranes. The peptide’s cationic nature allows it to selectively bind to and permeabilize the negatively charged membranes of bacteria, fungi, and some viruses, leading to cell death. Beyond its direct antimicrobial activity, LL-37 exhibits a wide range of immunomodulatory functions. It can chemoattract immune cells, such as neutrophils and monocytes, to sites of infection and inflammation. Furthermore, LL-37 can modulate inflammatory responses, influence cytokine production, and promote wound healing and angiogenesis. Key research areas for LL-37 include its potential as a therapeutic agent for infectious diseases, its role in inflammatory and autoimmune conditions like psoriasis and lupus, and its emerging connection to cancer biology. This product is intended for research purposes only and is not for human consumption.
CAS: 154947-66-7
PubChem CID: 16198951
Molecular Formula: C205H340N60O53
Molecular Weight: 4493.37 g/mol
Amino Acid Sequence: [LL-37, 37 aa] (37 aa)
Physical Form: Lyophilized Powder
Purity: ≥99%
Storage: -20°C, protected from light and moisture
All products on this site are strictly for analytical, research, laboratory, and development use only and are not for human or animal consumption of any kind and are not intended for medical, therapeutic, or diagnostic use.
The statements made within this website have not been evaluated by the US Food and Drug Administration.
The statements and the products of this company are not intended to diagnose, treat, cure or prevent any disease.
BioS Peptides is not a compounding pharmacy or chemical compounding facility as defined under 503A of the Federal Food, Drug, and Cosmetic act.
BioS Peptides is not an outsourcing facility as defined under 503B of the Federal Food, Drug, and Cosmetic act.
By accessing this site, you confirm that you are at least 21 years of age and that all products are sold exclusively for research, laboratory, and analytical purposes.