Launch Special: 25% Off EVERYTHING! Use Code LAUNCH25 at Checkout!

Need help? Call Or Text us, and a team member will be happy to assist you. +1-786-957-0245

  • Product Usage Notice: This product is intended strictly for research and laboratory use only. It is designated for in vitro testing and experimental purposes. Any use involving human or animal consumption is prohibited by law. All information provided on this website is for educational purposes only. This product must only be handled by licensed, qualified professionals. It is not intended for use as a drug, food, or cosmetic, and must not be misused, mislabeled, or misrepresented as such.
Sale!
LL37

LL37

LL-37 is a human cathelicidin-derived antimicrobial peptide with 37 amino acids. Research investigations are examining its membrane-active properties, immunomodulatory effects, and antimicrobial mechanisms. Studies explore its interactions with bacterial membranes, toll-like receptors, and inflammatory signaling pathways. Scientists continue to investigate its role in innate immunity and host defense mechanisms.

This material is for research purposes only and is not intended for human use.

Note: Current batch was underfilled from manufacturer.  Pricing is discounted to reflect this.

Original price was: $125.00.Current price is: $110.00.

  • Peptides will arrive in a lyophilized (powder) form for maximum stability
  • Order Now, Ships Today
Purchase Peptides

Description

LL-37, the only human cathelicidin, is a 37-amino acid peptide that serves as a critical component of the innate immune system. Its primary mechanism of action involves the disruption of microbial membranes. The peptide’s cationic nature allows it to selectively bind to and permeabilize the negatively charged membranes of bacteria, fungi, and some viruses, leading to cell death. Beyond its direct antimicrobial activity, LL-37 exhibits a wide range of immunomodulatory functions. It can chemoattract immune cells, such as neutrophils and monocytes, to sites of infection and inflammation. Furthermore, LL-37 can modulate inflammatory responses, influence cytokine production, and promote wound healing and angiogenesis. Key research areas for LL-37 include its potential as a therapeutic agent for infectious diseases, its role in inflammatory and autoimmune conditions like psoriasis and lupus, and its emerging connection to cancer biology. This product is intended for research purposes only and is not for human consumption.

CAS: 154947-66-7
PubChem CID: 16198951
Molecular Formula: C205H340N60O53
Molecular Weight: 4493.37 g/mol
Amino Acid Sequence: [LL-37, 37 aa] (37 aa)
Physical Form: Lyophilized Powder
Purity: ≥99%
Storage: -20°C, protected from light and moisture