Need help? Call Or Text us, and a team member will be happy to assist you. +1-786-957-0245

  • Product Usage Notice: This product is intended strictly for research and laboratory use only. It is designated for in vitro testing and experimental purposes. Any use involving human or animal consumption is prohibited by law. All information provided on this website is for educational purposes only. This product must only be handled by licensed, qualified professionals. It is not intended for use as a drug, food, or cosmetic, and must not be misused, mislabeled, or misrepresented as such.
Cagrilintide

Cagrilintide

Cagrilintide is a 38-residue acylated amylin analogue. Suitable for amylin-receptor binding, cyclic-AMP, metabolic-pathway, and peptide-formulation research. Research use only; not for human or veterinary use.

$80.00

  • Peptides will arrive in a lyophilized (powder) form for maximum stability
  • Order Now, Ships Today
Purchase Peptides

Description

Cagrilintide is a 38-residue, acylated amylin analogue. It is used in amylin-receptor binding, cyclic-AMP, and metabolic-pathway studies, as well as peptide formulation analytics. Supplied as lyophilized powder for research use only; not for human or veterinary use.

CAS: 1415456-99-3
PubChem CID: 171397054
Molecular Formula: C194H312N54O59S2
Molecular Weight: 4409 g/mol
Amino Acid Sequence: Modified 38-residue amylin analogue; PubChem sequence: XKCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP (X denotes the N-terminal modified residue)
Physical Form: Lyophilized Powder
Purity: ≥99%
Storage: -20°C, protected from light and moisture

Research Use Only

All products on this site are strictly for analytical, research, laboratory, and development use only and are not for human or animal consumption of any kind and are not intended for medical, therapeutic, or diagnostic use. 

The statements made within this website have not been evaluated by the US Food and Drug Administration.  

The statements and the products of this company are not intended to diagnose, treat, cure or prevent any disease.    

BioS Peptides is not a compounding pharmacy or chemical compounding facility as defined under 503A of the Federal Food, Drug, and Cosmetic act.  

BioS Peptides is not an outsourcing facility as defined under 503B of the Federal Food, Drug, and Cosmetic act.

By accessing this site, you confirm that you are at least 21 years of age and that  all products are sold exclusively for research, laboratory, and analytical purposes.

Agree and Continue